sunnie 2022-03-30 14:34:58

SupplyName:(Arg6)-Amyloid beta-Protein (1-40) Sequence (single letter abbreviation):DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Sequence (three letter abbreviation):H-Asp-Ala-Glu-Phe-Arg-Arg-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) Basic description:This peptide is the biologically active domain of the amyloid beta-protein for neurotrophic and neurotoxic effects, which is homologous to a region in peptides of the tachykinin family Reference:Y.Hori et al., J. Biol. Chem., 282, 4916 (2007) K.Ono et al., J. Biol. Chem., 285, 23186 (2010) B.Alies et al., Inorg. Chem., 50, 11192 (2011)